PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g444860.1
Common NameMTR_7g444860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 315aa    MW: 34548.4 Da    PI: 8.6626
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g444860.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.52.9e-41148225178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqv+gC++ l +akeyhrrhkvCe+hskap+v+v gleqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  Medtr7g444860.1 148 RCQVDGCNVALMNAKEYHRRHKVCEMHSKAPKVVVLGLEQRFCQQCSRFHVVSEFDDSKRSCRRRLAGHNERRRKSSH 225
                      6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-34145210IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.223146223IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.03E-39147228IPR004333Transcription factor, SBP-box
PfamPF031101.2E-32149222IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MDFGGNMFCL NNRDQSNTNN NGNSNGFTWC SSGSTTTGTA WNMNTFNVNE VNNSVSAANR  60
TEAGLANALM YLPQNEGGGR QYQSAYGGGV SRGHMMPDPH LTCLKLGKRH YFEDVSGGGG  120
VMGEKKGKGG YCGGGKTAAV GGYTAVTRCQ VDGCNVALMN AKEYHRRHKV CEMHSKAPKV  180
VVLGLEQRFC QQCSRFHVVS EFDDSKRSCR RRLAGHNERR RKSSHDSVGR NSSQGGCALS  240
LLSSRTDSWL SPADLSVRCS AALSELIAEN RASIMARQYV SDRDWHLQHH AVEDYKEIQS  300
ESNYFPQHMF PQTH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-32142222484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127135KGGYCGGGK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1517430.0AC151743.28 Medicago truncatula clone mth2-25e15, complete sequence.
GenBankAC1519150.0AC151915.8 Medicago truncatula clone mth2-30n12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013448322.10.0squamosa promoter-binding-like protein
SwissprotQ7XT426e-58SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
SwissprotQ01JD17e-58SPL7_ORYSI; Squamosa promoter-binding-like protein 7
TrEMBLA0A072TXZ60.0A0A072TXZ6_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA01G15134.11e-140(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.13e-36squamosa promoter binding protein-like 5
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]